PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof008442
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family DBB
Protein Properties Length: 290aa    MW: 31661.2 Da    PI: 7.677
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Sof#S17311802PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.22.1e-055381441
   zf-B_box 14 lqlfCedCqqllCedClleeHkg......Htvvp 41
               ++  C  ++  lC+ C +e+H        H++ p
  Sof008442  5 ATVVCCADEAALCARCDVEIHAAnklaskHQRLP 38
               7899*****************6678888888877 PP

2zf-B_box28.33.6e-094879334
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeH 34
                ++C+ ++ek++ +fC +++ l+C+dC + +H
  Sof008442 48 LPRCDVCQEKPAFIFCVEDRALFCRDCDEPIH 79
               689**************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.1E-4139IPR000315B-box-type zinc finger
SMARTSM003363.4E-144693IPR000315B-box-type zinc finger
PROSITE profilePS501198.6034693IPR000315B-box-type zinc finger
PfamPF006435.1E-74889IPR000315B-box-type zinc finger
CDDcd000211.11E-94990No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
XAAAATVVCC ADEAALCARC DVEIHAANKL ASKHQRLPLG DGDAAPSLPR CDVCQEKPAF  60
IFCVEDRALF CRDCDEPIHV PGTLSGNHQR YLATGIRVGF SSVCGAAGAE GIPPPAPPKG  120
GSKPAAVGGA TKTTTVKDTL PQEVPSSPFL PPSGWAVEDL LQLSDYESSD KKDSPLGFKE  180
LEWFADIDLX HAHSPRKNTN GGGPRTFTPW RRPASNRRVL TRPNGVYAPR NKESPGMEGG  240
LVRTNRGNYL FFPFPWILWA GRNEKENDWH REYFPGTMGE GERRDNTKKW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.114240.0crown| leaf| meristem| root| seed| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448103.11e-114hypothetical protein SORBIDRAFT_06g021170
SwissprotQ962884e-55BBX24_ARATH; B-box zinc finger protein 24
TrEMBLC5YBE41e-114C5YBE4_SORBI; Putative uncharacterized protein Sb06g021170
STRINGSb06g021170.11e-114(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06040.18e-43DBB family protein